SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491929|ref|YP_003722106.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491929|ref|YP_003722106.1|
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily YajQ-like 2.14e-27
Family YajQ-like 0.0009
Further Details:      
 
Domain Number 2 Region: 91-163
Classification Level Classification E-value
Superfamily YajQ-like 8.37e-27
Family YajQ-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491929|ref|YP_003722106.1|
Sequence length 163
Comment hypothetical protein Aazo_3306 ['Nostoc azollae' 0708]
Sequence
MASTFSFDIVSDFDHQELVNAIDQVVRDIKSRYDLKDTQTTVELGEKSITISTDSDMTLH
AVHSILREKVAKRNLSQKILDFGKVESASGNRVRQEITLKKGISQEIAKQISKLIREEFK
KVQASIQGDTMRVTAKAKDDLQTVIQRLKQEDFPVALQFTNYR
Download sequence
Identical sequences D7E2G1
WP_013191997.1.25658 gi|298491929|ref|YP_003722106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]