SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298493168|ref|YP_003723345.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298493168|ref|YP_003723345.1|
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 7.19e-53
Family MoeA N-terminal region -like 0.0000758
Further Details:      
 
Domain Number 2 Region: 180-325
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 2.09e-41
Family MoeA central domain-like 0.0000739
Further Details:      
 
Domain Number 3 Region: 333-407
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 0.0000000458
Family MoeA C-terminal domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298493168|ref|YP_003723345.1|
Sequence length 407
Comment molybdenum cofactor synthesis domain-containing protein ['Nostoc azollae' 0708]
Sequence
MLSVRDAEATIFNAIQPLDNQQDIEFVDLLMANNRILATPVTSSFDFPHWDNSAMDGYAV
RYADVQQARANKPIILTVVEEIPAGYQPQVTIKPGEAARIFTGAVMPTGADTVVMQEKTH
QEENRIFIFAAPQLEEFVRRKGDFYQAGKQLLPAGISLNASEIGVLAGAGREQVCVFRRP
RVAILSSGNELVMPEEMLKPGQIVDSNQYALATLVRELGAEVLLLGIVKDDPTALKEIID
YAIANADIVISTGGVSVGDYDYIDKILVSLGAKVHFSSVQMRPGKPLTFATFPNSLYFGL
PGNPVSGLVTCWRFVQPTIKKLAGLSKGWEGKFLKVRSHSELQSNGKMETYVWGKLHLVN
GGYQFHKAEGNDSSGNLINLAQTNALAVLPVGKTLVYSGEEVFVLQL
Download sequence
Identical sequences D7E052
gi|298493168|ref|YP_003723345.1| WP_013193231.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]