SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297621039|ref|YP_003709176.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621039|ref|YP_003709176.1|
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.27e-34
Family Ribosomal protein S14 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297621039|ref|YP_003709176.1|
Sequence length 101
Comment 30S ribosomal protein S14 [Waddlia chondrophila WSU 86-1044]
Sequence
MAKKSSIAKQKRREKIVNRNWEKRQELKKKVSDINLSEEERLEASIQLNKMRRDTSPVRL
RNRCQITGRCRGYLSKFKVSRLVFREMASIGMIPGVTKSSW
Download sequence
Identical sequences D6YVK9 F8LCC3
WP_013181888.1.19835 WP_013181888.1.67671 gi|297621039|ref|YP_003709176.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]