SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310287134|ref|YP_003938392.1| from Bifidobacterium bifidum S17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310287134|ref|YP_003938392.1|
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.26e-25
Family Thiamin pyrophosphokinase, catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 146-206
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.00000157
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310287134|ref|YP_003938392.1|
Sequence length 242
Comment thiamin pyrophosphokinase [Bifidobacterium bifidum S17]
Sequence
MAYERCVIFGAGEYYEGPAPAIEKGMLAIAADGGLDHMRAMGLSPDFVIGDFDSLSGDVP
DGDRSVRLPPQKDDPDLLSALKVGWSRGAREFHIYGALGGRIDHTIANMQLMALLASHGG
IGYLYGDGSIVTAIADGALEFPANHVAPRRMISVFSHSDVCHGVTIAGLKYVLEGAALAN
TVVQGVSNEFVDGSAATVSVESGTLIITFPIEAPLPVVRLRHPFGGDLGALDTTVSSALA
VR
Download sequence
Identical sequences A0A0H2P1M9 A0A1V8R1Y3 E3ENU3 K2M437 U2DTG1
WP_003820866.1.26466 WP_003820866.1.37813 WP_003820866.1.53194 WP_003820866.1.54468 WP_003820866.1.55739 WP_003820866.1.56383 WP_003820866.1.70584 WP_003820866.1.7567 WP_003820866.1.80288 WP_003820866.1.84149 WP_003820866.1.97298 gi|310287134|ref|YP_003938392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]