SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330839299|ref|YP_004413879.1| from Selenomonas sputigena ATCC 35185

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330839299|ref|YP_004413879.1|
Domain Number 1 Region: 50-171
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 4.58e-46
Family Insert subdomain of RNA polymerase alpha subunit 0.0000267
Further Details:      
 
Domain Number 2 Region: 4-50,172-227
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.2e-31
Family RNA polymerase alpha subunit dimerisation domain 0.0007
Further Details:      
 
Domain Number 3 Region: 251-316
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 4.84e-25
Family C-terminal domain of RNA polymerase alpha subunit 0.0000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330839299|ref|YP_004413879.1|
Sequence length 319
Comment DNA-directed RNA polymerase, alpha subunit [Selenomonas sputigena ATCC 35185]
Sequence
MIEIEKPKIEIVEISEDNRYGKFVCEPLERGYGTTLGNSLRRILLSSLPGAAITSIRIDG
VLHEFSTIPGVRDDVTNIVLNLKSLCFKMYSEEPRVLRLDVKGEKEITAADIITDPDVEI
LNPDLHIATLNEDGELHMEMIVERGKGYVAAEKNKKPDHVIGVIPIDSIFSPIQRVNYTV
QDTRVGNVTDYDKLILDVWTDGSIRPEEGVSRAASILISHFKLFQNMAGIPEIEEEEEIA
PPEPEEPDASKVLETTIDDLDLSVRSFNCLKRANINTVADLVSKTEEDMMKVRNLGRKSL
EEVKKKLEEYDLTLKKEEE
Download sequence
Identical sequences C9LTF6
WP_006191773.1.43677 WP_006191773.1.73955 gi|330839299|ref|YP_004413879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]