SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147919037|ref|YP_687236.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147919037|ref|YP_687236.1|
Domain Number 1 Region: 4-143,221-261
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.14e-28
Family Protein prenyltransferases 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147919037|ref|YP_687236.1|
Sequence length 265
Comment hypothetical protein RRC149 [Methanocella arvoryzae MRE50]
Sequence
MSQTVDLAVRYLTQAQNSDGSWGSGDPMVSARAIYALKDCEGSEAVIERGIAYLESCQQP
DGHFPPKTQMYTDAATTAYALVALNQYSYSKASKLVSRGLIWLMEHQQPDGSWSGHNTNK
NAYTTSLCLRALYTFYLTGISRYRKGVTHVMEKMAEPGFFDEPVSHVYAPVLNMHRIGYL
MPEVREAFVNYATEHIDLSMKAGKIVDVAYLCGTLAALDEEDMARQCADYLAGARNSDGG
YGKETGQASDPNWTALVMLALENRL
Download sequence
Identical sequences Q0W133
gi|147919037|ref|YP_687236.1| 351160.RRC149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]