SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147919586|ref|YP_686674.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147919586|ref|YP_686674.1|
Domain Number 1 Region: 1-274
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 2.35e-124
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147919586|ref|YP_686674.1|
Sequence length 274
Comment F420-dependent methylenetetrahydromethanopterin dehydrogenase [Methanocella arvoryzae MRE50]
Sequence
MTVRVGIVKLGNIGTSRFIDLVLDERADRDIYVRTVGAGAKMGEAEAEEMKKIIDFKPQF
CIVISPNATVPGPTKAREMLKEAGIPTIVISDSPVLKIKDDLKAKGFGYFVVKCDPMIGA
RRQFLDPTEMVLFNADVLKVLANTGVVRLIQKELDAVIEGFAAGQTPALPQIVISADKAV
AAAGYKNPYAKAKAMAAFVAAEKVADIDLQGCFMQKEMEQYIPTVASAHELLREAAKLSD
EARELEKATDAILRTPHAADGKVLSKTQLMLKPE
Download sequence
Identical sequences Q0W2P5
WP_012035233.1.28485 351160.RCIX2230 gi|147919586|ref|YP_686674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]