SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147919724|ref|YP_686530.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147919724|ref|YP_686530.1|
Domain Number 1 Region: 276-555
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.14e-147
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000000993
Further Details:      
 
Domain Number 2 Region: 4-275
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.84e-142
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000851
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147919724|ref|YP_686530.1|
Sequence length 556
Comment methyl-coenzyme M reductase, alpha subunit [Methanocella arvoryzae MRE50]
Sequence
MAVKETQKRFIKAMKKKFAEEPTAQVTKFKYEGYTQSKRKVEFKKTGDAIAKKRGISMYN
PMVHMGGIPLGQRQLMNYVVSGTDIAVEGDDLHFVNNAAMQQFWDEIRRTVIVGLDTAHA
TLEKRLGKTVTPETISNYLAVLNHAMPGAAVVQEHMVETHPGLTDDCFVKVFTGDDELAD
SIDKQYVLDINKAFPKEQAAQLKKAIGKQLFQAVHIPTIVVRTCDGGTTSRWSAMQIGMS
FIDAYKMCAGEAAVADLAFAAKHASVVEMGNLLPARRARGPNEPGGVSFGFLADIVQTHR
KYPDDPVKSSLETVASGCMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDDFCYYGYDYI
KGKYGIAKAKPTMDVVNDIGTEVTLYGIEQYEKYPTTLEDHFGGSQRATVLSAAAGVTTS
LATGNANAGLSAWYLSMYLHKEAWGRLGFFGYDLQDQCGATNVFSCRSDEGAIDELRGPN
YPNYAMNVGHQGGYTGIAGAAHYGRGDAWVASPLIKIAFADKSLAFDFTEPRKEFARGAI
REFMPAGERSLVIPAK
Download sequence
Identical sequences Q0W339
WP_012035370.1.28485 gi|147919724|ref|YP_686530.1| 351160.RCIX2063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]