SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147919728|ref|YP_686526.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147919728|ref|YP_686526.1|
Domain Number 1 Region: 189-443
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 4.45e-123
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000108
Further Details:      
 
Domain Number 2 Region: 2-188
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.51e-78
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147919728|ref|YP_686526.1|
Sequence length 443
Comment methyl-coenzyme M reductase, beta subunit [Methanocella arvoryzae MRE50]
Sequence
MPKYKDKIDLYDDKGKLLEKDVPLEAVSPIVNPAIRKIVNLTKRSVSVSLEGIENALKTG
KVGGKGRQVLGKSLDLPLTKDADKIAKKIEELVRVTKGDDTNVKVLGGGKSLLVQVPTQR
IEAGAEFVAGISSTATATVESILELYKVDMFDGAFVKAAVWGMYPQTIDLEGGNVKSILD
VPQKDEGVGYALRNIPTNHCVIISKRNAMNAAALNSIFEQAGVWEMGDAIGPWERYQLMG
FAYQGLNANNLVYSTVKENGKNGTVGSVVATIVGKAIEDKVIKVEKTLPSGYKVYTTDDI
PKWNAYAAAGVMAATMVNCGALRGAQAVSSTLLYYNDLLERETALPGVDFGKVQGTAVGF
SFFSHSIYGGGGPGIFNGNHVVTRHSKGFAVPCVSAACALDAGTQMFSPESTSKAMEVFG
EIPEFNQPLVAVAKGAKEIKDKI
Download sequence
Identical sequences Q0W343
gi|147919728|ref|YP_686526.1| WP_012035374.1.28485 351160.RCIX2059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]