SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147919872|ref|YP_686377.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147919872|ref|YP_686377.1|
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-67
Family Formaldehyde-activating enzyme, FAE 0.00000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147919872|ref|YP_686377.1|
Sequence length 163
Comment putative formaldehyde-activating enzyme [Methanocella arvoryzae MRE50]
Sequence
MKSLIGEALVGEGNEVAHIDLAIGLKGTPFETAFMSALMQPAMGHSPLLAVLEPNLPCKP
STLMANKVTIKNASQATLMFGPAQAAVANAVTDCVSEGVIPKGQAEDLLLIVSVFIHWDA
KDKQKIYDYNYEATKLAIKRAFDGEPKIDEILARRKTAKHPFA
Download sequence
Identical sequences Q0W3J2
gi|147919872|ref|YP_686377.1| WP_012035518.1.28485 351160.RCIX1876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]