SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|523529714|ref|YP_008215741.1| from Acinetobacter baumannii BJAB0715

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523529714|ref|YP_008215741.1|
Domain Number 1 Region: 8-245
Classification Level Classification E-value
Superfamily PP2C-like 9.02e-28
Family PP2C-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|523529714|ref|YP_008215741.1|
Sequence length 248
Comment Serine/threonine protein phosphatase [Acinetobacter baumannii BJAB0715]
Sequence
MQGLTWKARSKYQQDAILIENKVIQHDGLITKLYSHSEKEQWCVAVADGISNSPVAEQAA
YTVLNALMQNKKIETCQAFTIQQYLVDQLAHQKNSFGASSTLALIQNNGEQGFVTIQHIG
DSRVYLFSQHDQKWHCLTRDHNYLEQLRENGEIKEGGNYASIYGALLQYFCADPLHEVMD
FTTTEEYLTENDALLVCTDGVHDVMECTEWPALKVDMELRAWLIDMKASLDSKQAYDNVS
MILVRAKF
Download sequence
Identical sequences gi|523529714|ref|YP_008215741.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]