SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Hydpi2|116756|fgenesh1_kg.35_#_2_#_Locus4302v1rpkm56.34 from Hydnomerulius pinastri v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hydpi2|116756|fgenesh1_kg.35_#_2_#_Locus4302v1rpkm56.34
Domain Number 1 Region: 189-276
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000246
Family Glutathione peroxidase-like 0.056
Further Details:      
 
Domain Number 2 Region: 422-464,501-541
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000362
Family UBX domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Hydpi2|116756|fgenesh1_kg.35_#_2_#_Locus4302v1rpkm56.34
Sequence length 561
Sequence
MERLSTNQQQVLQQLQALLGPHEHDVEVLISVLQSLDWNVQTATELLLDGPPVEVRSSQR
SIRQTQQPMIPLEYPVQERGHGAPRSLTQTFLALLSLPVSVLSGILRFVLGILRVPFLFN
NNHTYRALRQTFPDTRGATRRWITALEEETGAVSIKSTGALTTGLDNPPSTSRRHAYPPT
SPSDGSKVLPDFFDGTYEEVLDICQREGRIACVILVSDEHDDVPEFKRSTLTDATLVRML
SEKNFVVWGGDVRDKVSWEAAQKLQATTYPFVAFLALQPRRNPSTSSSNSSPILTVLSRH
HGPSVPDSGPTSAQTLVHHLEHQLLPRVNPFLTRYKSQLQERERDRHLREQQDKAFEDSA
RRDRERVEARIREEQEEAGRLRMEEEARRQEEKRTQAERERQESAQAMRLQWRRWMRRSI
VPPEPRGGNAIRLAIKLPGSGRVVRAFPSVSTLTALYAFADAQTIPLTMQLEGDPERVPE
GPEGGLETLENYIQSQTQGPESWWGFKLALAYPRREIKWIANTTLVEAGLKNGEQLVMEA
TNSSYSSTSHPSDDDYESESD
Download sequence
Identical sequences A0A0C9WAV7
jgi|Hydpi2|116756|fgenesh1_kg.35_#_2_#_Locus4302v1rpkm56.34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]