SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341581257|ref|YP_004761749.1| from Thermococcus sp. 4557

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|341581257|ref|YP_004761749.1|
Domain Number - Region: 61-128
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.0136
Family AlaX-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|341581257|ref|YP_004761749.1|
Sequence length 136
Comment hypothetical protein GQS_00845 [Thermococcus sp. 4557]
Sequence
MGGRVLVVGFMPDEVEKLRKALSVPVFEVPEYCRDWAVSEVVDKAAELSGSSYWHLRKFV
IMHAVDNETLKEVIRSVKSLNLGRVIFATTTGTSLTWKLEDLLNELMAEDEYFKAARWAR
EEAKKRKGPFLDIGKK
Download sequence
Identical sequences G0HKE1
WP_014011757.1.67626 gi|341581257|ref|YP_004761749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]