SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341581280|ref|YP_004761772.1| from Thermococcus sp. 4557

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341581280|ref|YP_004761772.1|
Domain Number 1 Region: 15-243
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00000000000000147
Family Protein prenyltransferases 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|341581280|ref|YP_004761772.1|
Sequence length 288
Comment hypothetical protein GQS_00960 [Thermococcus sp. 4557]
Sequence
MGSKLYDIGRFINADSLIRYIEERRHKDGGYCFVSVLNDTNVNDTYYAIKIYNLLGIEFP
EPEKTIEFLSNAIQPQTAVVAIAMVLEGLAILGAEDVAKEHLDIVFTKYNPLEGKFAVGL
GGSEEFGTATPLEATYWVVKAFDAIGIKFNPDEREAIREFIMKFRNGNGYGVKQPTTTMT
YQAIFSLRKLGYRPPRSPHFRNCELCGDWGGFTEVPYSLPPYLEPTFYATRGLELQGESP
SCPRRHVWFIRQLQNPNGGFRRSLELGISNFQNTYRALAVLDFMERFL
Download sequence
Identical sequences G0HKG4
WP_014011780.1.67626 gi|341581280|ref|YP_004761772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]