SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341582218|ref|YP_004762710.1| from Thermococcus sp. 4557

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341582218|ref|YP_004762710.1|
Domain Number 1 Region: 31-221,252-290
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.83e-23
Family Terpene synthases 0.022
Further Details:      
 
Domain Number 2 Region: 310-515
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.84e-18
Family Terpene synthases 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|341582218|ref|YP_004762710.1|
Sequence length 741
Comment hypothetical protein GQS_05665 [Thermococcus sp. 4557]
Sequence
MKKVLAAIMIVLMLIPAVGAGKIDGSVTFLSGASQSTKETREVSLALMALVSARDDVNWD
ITPDIDALVDELLDNQNQDGGWGHYFNEPSNVLDTAYAVIALTRAYPLMDVWKARDVERA
IDSGIDYLLSAKEENGWGYIPGTPVSCYPTVVALWALGENGYTYNSRTVRDAVRYLESIN
ASSCEISNYEFLALRVVAYHSTGYPLGSDVADQLKDILLKERMEVKERAMLTYALVLVSP
LDLDVARALKMLEKEGRSSDDIFYWMNTPSLMSQTEIIASTAFALMALSHPLKVTIPGEV
TNPYTMPCRELKYMQNLDGGWGLVLNEPSNEKATYYALLGLEKCYPTNESISKALEWARN
AFERDALWVQKNGRMSVGYYYALETLLRYNLLSEEEKASAVELIRNAQLDYGLWGNTVLG
PQPYETALAVKALLDLGVPANDPLIQAAKEWLLSISNGGWGTHVTTPHFSYMLKPDVLTT
ITVLEALENVATPEELEPHLQWLMDQRINGGWAYWKAYYVWQENREYPGTPSVELTVRAT
DMLLRYGHNYTSKTLDFVMNARDSGLIRNKPIETANAVLYLCRFQYIPPVSLNDVRAELD
SDIFEVIAPGMDNESVAEIVNRLSDTFSGGFIAANGTGIGEGSYIVLSNFSGYSIRVYNP
YLPFHIDGDNVTVGNVTVPLNKSVVLIPGKTPEGVVLFVFYEPENEGIAKDVFTTGFIKY
IGGSAMVLVVENGRIKVIAVG
Download sequence
Identical sequences G0HJA4
gi|341582218|ref|YP_004762710.1| WP_014012716.1.67626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]