SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341582406|ref|YP_004762898.1| from Thermococcus sp. 4557

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341582406|ref|YP_004762898.1|
Domain Number 1 Region: 57-264
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.39e-56
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 306-502
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.23e-49
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0001
Further Details:      
 
Domain Number 3 Region: 603-752
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.02e-47
Family AlaX-like 0.00072
Further Details:      
 
Domain Number 4 Region: 512-599
Classification Level Classification E-value
Superfamily Translation proteins 2.44e-18
Family AlaX-M N-terminal domain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|341582406|ref|YP_004762898.1|
Sequence length 913
Comment alanyl-tRNA synthetase [Thermococcus sp. 4557]
Sequence
MSMDMTTRMFKEEGWIRKQCPKCGKFFWTLDPDRETCGDPPCDEYSFIGKPGIPKKYTLE
EMREKFLSFFEKHGHGRVKRFPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPLTIS
QPSIRFTDIDNVGITGRHFTIFEMMAHHAFNYPGKPIYWMDETVELAFEFFTKELGMKAE
DITFKENPWAGGGNAGPAFEVLYRGLEVATLVFMQYKKAPKDADPAQVVEIKGDYYVPME
TRVVDTGYGLERLVWMSHGTPTAYDAVLGYVVEPLKRMAGVEKIDERILMENSRLAGMFD
IEDMGDLRYLREQVAKRVGISVEELTKAVRPYELIYAVADHTKALTFMLADGVIPSNVKA
GYLARLLIRKSIRHLRELGLGIPLAEIVAMHIKELSPTYPEFKEMEDVILDIINVEEKRY
QETLRRGSDLVKREVAKLKKAGRDEIPLERLLLFYESHGLTPEIVAEVAQKEGIKVEIPD
NFYTLVAKEAEKTEKKTAAEYAVDFELVKDLPDTKTLYYEDPFMKEFDAEVLKVIDDWVI
LNQTAFYPEGGGQPCDLGELEVEGEKVEVRDVQKIGKVILHRVERPELFKPGAKVHGRID
WDRRIQHMRHHTGTHVLMGALVRVLGKHVWQAGSQLHTDWARLDISHYKRISEEELREIE
RLANRVVMENRKVTWEWLPRTEAEMKYGFRLYQGGVVPGRVIRVLKIEDWDVQACGGTHL
PNTGLVGPIKILRTERIQDGVERIIFAAGEAAVDWMQETERLLKKTAEVFRVPPEKVPET
AERFFNEWKAAKKEVEKLRKELAKLLVYELEGKVEKVGEVEFIGAVVEGAMDDLREAANK
LRKEKRVIVLISREGHFVVAVGDGLDVKAGELARAVTSVAGGGGGGRKELAQGRIKNPLK
AEEAIEEVKKRLG
Download sequence
Identical sequences G0HK59
WP_014012903.1.67626 gi|341582406|ref|YP_004762898.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]