SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341582832|ref|YP_004763324.1| from Thermococcus sp. 4557

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341582832|ref|YP_004763324.1|
Domain Number 1 Region: 54-234
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.86e-16
Family Complement components 0.064
Further Details:      
 
Domain Number 2 Region: 358-485
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00000000000014
Family Terpene synthases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|341582832|ref|YP_004763324.1|
Sequence length 589
Comment membrane protein [Thermococcus sp. 4557]
Sequence
MRGILAVGVLLMLIVSTASGAEAGSAEIMPYVYEPTVPDTAFSVLAFYENGDYARVLEGC
EWLMMLKTPFDSWGFAQGEEHEAKYTAMAMMALMRGERVARGRYNSTLNSAAYWLIYTQN
PDGSWGDYTDTALALIALREFLNGYINENLTGFEKQVGEAVDRATGWLMGTEPKTDTERI
FGYMALGKREELEKMEVSGELEAYRAFALAYLGEGVELDGNFKSTVALAMALYATLNGKY
REELLQREHFGFWGTLHYRVLDLLSVSKIGGFENLRPTACPYLSKVHPTDDWERVILADY
YLLCNITPELPSNLSALLPWQVAELARVKALMGEDYSAEVSYLLSTSENGVWKDFYNTEY
VVWVFRTLNMSYDYSKSLDYLSKNLTWMLSTKDPKTGNPVYYNTPTYYFAYALLVFRSFG
MERELNKTLNVLAERQYENGAFPYTQGSIAGITSTAKAVWALHEAGLTDTELYEKGVSFL
RSLLYAEIPSPEVGENAVSLANATFLLVRDGSYAGNSTGRAELTGLDGYVVIYPSKNPLV
ISAEEVNGFRAVEPATGDERTAYFYIAAGVALIALAVVVVRRGRRGGRK
Download sequence
Identical sequences G0HMR5
gi|341582832|ref|YP_004763324.1| WP_014013329.1.67626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]