SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341583137|ref|YP_004763629.1| from Thermococcus sp. 4557

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|341583137|ref|YP_004763629.1|
Domain Number - Region: 24-95
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0324
Family Seryl-tRNA synthetase (SerRS) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|341583137|ref|YP_004763629.1|
Sequence length 97
Comment hypothetical protein GQS_10295 [Thermococcus sp. 4557]
Sequence
MSEIKIILEKEKFKSLKGRDINALLRENLPRMEDTLKAEREEILLEKVAKLEEKLREMEG
EIEELREFYERALRDKEFMMAERERLRKENEELRKKV
Download sequence
Identical sequences G0HPA2
WP_014013634.1.67626 gi|341583137|ref|YP_004763629.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]