SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219850763|ref|YP_002465195.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219850763|ref|YP_002465195.1|
Domain Number 1 Region: 20-239
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.28e-32
Family Acetylhydrolase 0.027
Further Details:      
 
Domain Number 2 Region: 1093-1233
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.99e-26
Family Family 6 carbohydrate binding module, CBM6 0.003
Further Details:      
 
Domain Number 3 Region: 262-406
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-25
Family Family 6 carbohydrate binding module, CBM6 0.0022
Further Details:      
 
Domain Number 4 Region: 645-784
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-25
Family Family 6 carbohydrate binding module, CBM6 0.0026
Further Details:      
 
Domain Number 5 Region: 867-1007
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.08e-25
Family Family 6 carbohydrate binding module, CBM6 0.0013
Further Details:      
 
Domain Number 6 Region: 445-585
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.89e-22
Family Family 6 carbohydrate binding module, CBM6 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219850763|ref|YP_002465195.1|
Sequence length 1234
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MRSEILCCYIVLAMLLGGSLLVIHADATVNILPLGDSITRGGTTADSPYPSYRYLLWNYL
KTGGYDVNFIGSTTFPTFSSFSFDQNHEGHGGYTTGMELAGDSSDDPSAKLSNWLKLYTP
DIVLLHIGTNDVIQQVPLATRLSNDAQIIDTLRADNPNVKILIAQIIPTSDSFRNTNSQL
IAYNNALPALAAQKSTAQSPVIVVDQYTGYNGFSDNQYDGIHPQTSGEKKMADRWYAALV
PLLSGGTTVEPTPVPTSAPWDSPQAIPGSIQATDYASGGEGVAYHDTTTGNQGGAYRNDD
VDIEYSSVEQEFVVAYIRSGEWLTYDVNIASGGIYTVNFRVSSPNTGSTIDLEVDGSEVT
MIQVPNTGSFDTYTAVQRPVYLPSGHHTLKLDFSGSSNVNYLKFTTGMPTPVPTGTTVSP
TPTGSQTITPTVTPTGVERAYVSHTFPCKVEAEDYDLGGEGIAYHDTTPGNLGGEYRSDD
VDIEAMSGGGSNVGYIKNGEWLAYTVSVPVTRTYVATFKSSSWAPGRSILVQVDGTPVTA
VGVPNTNSSNVYDSAQVALPMTQGMHRITLTFNGDCQNLDWFDVTNDMPTTVTTPVPTTV
VTTVPTTIVTTKPTTTTTTVPTTAPTTVVTTVKPTQTSLPYVAHRPPIRVEAEDYDQGGE
GVAYHDTTLGNLGGQYRQDDVDIETIAAGGYDVGYIKDGEWLTYTIDAPSTSAYTAVFRM
ASWGAGRSIGVSVDGVQVTTVPVAMTGSYSTFTLSAASFTMTQGTHKVRLTFNGDSQNLD
YFDLIPGNYAPTTTTVTPVPTTVMTTATVTTTAATTTVPTTTPTTTVPTTVVTTGTTTVT
TTAATTTVPTTAVTTVTTTPAPSGTVWQIPTHIEAEDYDQGGEGVAYHDTTLGNLGGQYR
QDDVDIEAISGGGYDVCYIRDGEWLRYHITVQNTGIYTATFRVGSWNQGRAITIGVDGVG
VAVAAVPNTGSSSAYTTTAVAVPLAAGDHMLTLTFNGDGQNLDWFTLGNGVIQTTTPTTV
APTTAPTTVPTTVVTTVKPTTTVTTVTPTTMATTVKPTTVVTTTISPTIPTIPVSTTATT
LPLPDTKAYTSLSLPGRLQAENYDNGGEGVGYHDTTPSNQGGAYRNDDADVESLIDNSGY
DVCWIRDGEWLKYTVTVQQSRTYGAAFRVASPQAGGQVELKVDGTSEVTVNVPNTGSFDI
YQSIGTQVPLTAGQHTITLAFHGSRMNVDYVDFV
Download sequence
Identical sequences B8GIC1
521011.Mpal_0078 WP_012616791.1.75456 gi|219850763|ref|YP_002465195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]