SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219850784|ref|YP_002465216.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219850784|ref|YP_002465216.1|
Domain Number 1 Region: 470-552
Classification Level Classification E-value
Superfamily PKD domain 2.49e-29
Family PKD domain 0.00037
Further Details:      
 
Domain Number 2 Region: 343-470
Classification Level Classification E-value
Superfamily PKD domain 7.19e-25
Family PKD domain 0.001
Further Details:      
 
Domain Number 3 Region: 795-878
Classification Level Classification E-value
Superfamily PKD domain 7.98e-25
Family PKD domain 0.00045
Further Details:      
 
Domain Number 4 Region: 959-1046
Classification Level Classification E-value
Superfamily PKD domain 5.36e-24
Family PKD domain 0.00043
Further Details:      
 
Domain Number 5 Region: 1132-1214
Classification Level Classification E-value
Superfamily PKD domain 3.79e-23
Family PKD domain 0.00079
Further Details:      
 
Domain Number 6 Region: 1297-1383
Classification Level Classification E-value
Superfamily PKD domain 2.88e-22
Family PKD domain 0.00075
Further Details:      
 
Domain Number 7 Region: 720-795
Classification Level Classification E-value
Superfamily PKD domain 3.4e-22
Family PKD domain 0.00056
Further Details:      
 
Domain Number 8 Region: 1043-1129
Classification Level Classification E-value
Superfamily PKD domain 3.79e-22
Family PKD domain 0.00091
Further Details:      
 
Domain Number 9 Region: 880-962
Classification Level Classification E-value
Superfamily PKD domain 1.7e-20
Family PKD domain 0.00057
Further Details:      
 
Domain Number 10 Region: 1213-1300
Classification Level Classification E-value
Superfamily PKD domain 3.66e-19
Family PKD domain 0.0019
Further Details:      
 
Domain Number 11 Region: 260-361
Classification Level Classification E-value
Superfamily PKD domain 0.000000000131
Family PKD domain 0.006
Further Details:      
 
Domain Number 12 Region: 1376-1479
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.00000000471
Family Hypothetical protein PA1324 0.016
Further Details:      
 
Domain Number 13 Region: 585-714
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000179
Family delta-Endotoxin, C-terminal domain 0.055
Further Details:      
 
Weak hits

Sequence:  gi|219850784|ref|YP_002465216.1|
Domain Number - Region: 196-273
Classification Level Classification E-value
Superfamily PKD domain 0.00903
Family PKD domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219850784|ref|YP_002465216.1|
Sequence length 1667
Comment PKD domain-containing protein [Methanosphaerula palustris E1-9c]
Sequence
MVNNEGNAEIMGVVLLIAIFVAAVGLMGITMLSAPQPEKVPAVALDFWADDSHTNISLIH
RGGETLNLSGAKLMVLYSGDSTAQDKTSAFNLTNSSGLSTRLSSTTPELYSIGDNLSFTA
DRKIDQVQLIWPGTGLASMTGGGGAVLLGAWSPDSSSGRNPPAAVTGAVPITFPYPSEGP
TWTQPTQNPTAPWVYFIANITATNGTVPINFTDLTDYHGWSSSYKRSWNFGDSGSNVITD
QTNPYTYPYYQAPTDWPYIKNYTVTLNLTDESDVLTPYSLARQNYISVYKSPIAGFDASP
LEGNSGMEVWFTNTTTGYETSLSWDFGDENRTTNAYPRPAFPYTYYNPGSIQQNYTASLI
ANVDLGDNPHESSDPFQRVIIVHPQVIAAFTATPMTGPAPLTVSFDSNSSQGYLLSYFWD
FGDGTTFTSQNPQHTYTTAGNYTVNLTVSNTLPGPNTSTTSRTITVTAPPLAPPVANFTA
TPMNGTAPLLVTFTDTSTNTPTTWNWSFGDGNTATLQNPTHTYTTPGAYTVTLTVSNAVG
NSTATKTVMVYNNQNTIRVDAGYGANSTDCLGNVWLADREYTSGMWGYSPTGAPLYSVNG
SIANTSDPALYRTSRWSTTGTVDYQFNVPNGNYNVQLKFAETDTSINAGNPRKFDVTVNN
NPVASSFDVYGTVGANSTADLYSNVTVIDNLIHVVLKGTTGQPMIAAIGIAPASTWVSPA
FTANQTIGNTQLPVQFNDTSTGTVNRWFWDFGDGATSTIQNPTHTYTLPGTYKVMLTAGN
ANQSGTVVKKDYITVGPALAANFTANPTTGIAPLAVGFTDTSTGNGISNWSWTFGDGATS
TIQNPTHTYTLPGTYNVTLTVTNPYASASTTKTITVHSLNPNFTANRTIGNAPLPVLFTD
TTTSDLAVNAWTWNFGDNSTATTQSPTHSYTTPGIYTVTLTVSNTSLGFTNTTTKSAYIT
VLQPLVPNFTANRTAGNGQVPVQFTDTTTGTSITTWTWNLGDGNTSTLQNPTHTYTTPGT
YTVTLTAGNAYGNGTVTRTGYITVYPPLVAAFGGAPLLGNAPLNVSFVDQSTGFTISGWN
WTFGDGTTSTSQSPQHTYTAGGNYTVTLTITNAYGTASISKPAFVTVLPQLVANFTANRT
AGNAQFPVQFTDTSTGSGINGWSWNFGDNTTTSAQNPTHTYTTAGNYTVSLTAFNPYGNT
TTIRTNYITVLNPPVAAFTGTPTVGNGQANVTFTDQSTGDGIITWAWTFGDGNTATTRSP
QHLYTNQGTIPKTFNVTLTVTNAYGSGTTTKTGYITVYPPLVANFTTTATTGYAPLQVDF
TDTSTGYNIIAWTWNFGDGSQTGISQNVSHSYNTPGTYTATLVVTNPFGQSTQATRTITV
NAPATTPTPAGGLINGTIYNDQNGDGVANTADPKLAGWTINLFLNGNVIATTTSDANGAY
AFYGLDNAKGYTVVEVLPMGWRGTNPAGGTTGSVQINPGSKSAYTNTNFWNYYKPVSPGG
PITLNAAKPGSLVSGGYFQFRDTVAWSGSTGVSIDGTFHQINQDDIVRLTIEKSGSANIQ
ISSGGIWTFTAPDATLSINGVVIQRGAVTGIAIHGFDTLQSTLAVTVPSQNVWTSFTVNG
GQVIPGQNDNRIINLYNVTTGTDGGLNLQVGADIYIIGSTGTYQLLP
Download sequence
Identical sequences B8GIE2
gi|219850784|ref|YP_002465216.1| 521011.Mpal_0100 WP_012616812.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]