SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219850789|ref|YP_002465221.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219850789|ref|YP_002465221.1|
Domain Number 1 Region: 217-355,389-570
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.26e-24
Family iota-carrageenase 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219850789|ref|YP_002465221.1|
Sequence length 609
Comment Parallel beta-helix repeat protein [Methanosphaerula palustris E1-9c]
Sequence
MTPSIPEILADLRRAAGELPPMAKAFLVAVAVMALLAVLAGIGLMALTPAPATPSLNLTA
GYDASSIHLYHSGGASLSNSSFLVLVDGVDETKNVTYSPPLQNGIFAPGSMMIIPATSPV
QGVSLVTADSHRTIIQSVYAEDFVLTTAGAPWSMAFPTQSNAQVQGVQAPAHSYTWPASP
TPSPGFDTVTPGMVTVAAANSADPSKAQFRCTGTDDQVVINRALATGASVQLMDGTFHCS
GRIVIPTHTTLAGAGTFQTIIEVKNSTDGYQPIEVSAPYVTLRGFSTAAQGFIMISASHV
RVQDVYATSLGTDGVRYRSAGNGMFFVWADHQDLSDIEFYNCTAYDCTTHGFNMNQDFTD
RVPHAIQNTRFVFCYAALCGYGEAGNSRSEWTTGFDLQEMNDLVDCQVLNCIADNNWESG
FHFEPGERVDDSGKEIGPATRTVGVVLQNCLSENNGYRNTNPAHYFMAGYYVHKNTVLTN
CRAVHNRNAGYFVQSGSNLTFDRCQDEQSTYGWLVIKSSSGITLSNCTADHPRIWSLWAS
STDDLTLNGFTQVSPGGARGTLAMLGWYRDEETYQKPVTHSTFEITTTGGGSLSPITKEG
DGNRYTLTP
Download sequence
Identical sequences B8GIE7
gi|219850789|ref|YP_002465221.1| 521011.Mpal_0105 WP_012616817.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]