SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219850853|ref|YP_002465285.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219850853|ref|YP_002465285.1|
Domain Number 1 Region: 87-474
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000659
Family Virulence factor P.69 pertactin 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219850853|ref|YP_002465285.1|
Sequence length 489
Comment hypothetical protein Mpal_0169 [Methanosphaerula palustris E1-9c]
Sequence
MTKKRIFSASILLMLLIAALVGSAAATDTTSPVKTTGVADTTIAPSNSSMAPSGTPPGAP
PDNISGTPPGNPPGSTGDGMMGQPGGSTGTADYTLSGAFTVDNQTIAESNGTYTASTTNQ
SAIYVTNNGNLTLTNATILTSGNTSSSDASSFYGLNGAVLANNGSTVTITGGNITTTGSG
ANGAIPTGNGTTINLFGINITASGDGGHGVMATLGAALNLVDVNISTTGSHGAPLATDRG
SGTVNVTRGTINSSGTDSPGIYSTGVINVTDATIISNGTEAGVIEGFNSINLKNTTLSGG
VEKTGGIMVYQSASGDAATGTGNVTINGGTYTATAGPAFYVTNTDANINLTGVNVTAASG
TLVKAAGGSQWGTNGTNGGIVNFTADGETLNGSLVADNISSIAATLTNGSTLNGAITNAS
LTLNSTSTWSVTGNSTLTALTDSSGISGNVITNIIGNGFTVTYDKNLTQNSTLDGKTYTL
TNGGNLTPA
Download sequence
Identical sequences B8GIY9
WP_012616881.1.75456 gi|219850853|ref|YP_002465285.1| 521011.Mpal_0169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]