SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219850914|ref|YP_002465346.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219850914|ref|YP_002465346.1|
Domain Number 1 Region: 4-243
Classification Level Classification E-value
Superfamily Aquaporin-like 8.5e-59
Family Aquaporin-like 0.0000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219850914|ref|YP_002465346.1|
Sequence length 247
Comment MIP family channel protein [Methanosphaerula palustris E1-9c]
Sequence
MPSLMKRSLAEMVGTLLLVYFGAGAAAVTLMIAHGATPPNKFNIGIGALGGLGDWLAIGL
AFGIVIAAVIYAFGRISGAHLNPAVSIALWATKRFPTGDMVAYIIAQLIGASVGSLLFAA
TAGMDAVMIGGLGATAPFPGIGMGAAILAELLGTFVLMLTIMGVAVDKRAPEGFAGLIIG
LTVAGMITTIGNISGASLNPARTFGPFLGDLLLGGSNLWANYPIYVIGPIAGALIAAFLY
DYLNAED
Download sequence
Identical sequences B8GJ50
gi|219850914|ref|YP_002465346.1| WP_012616942.1.75456 521011.Mpal_0239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]