SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851070|ref|YP_002465502.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851070|ref|YP_002465502.1|
Domain Number 1 Region: 19-46,87-241
Classification Level Classification E-value
Superfamily SGNH hydrolase 9.31e-33
Family Acetylhydrolase 0.026
Further Details:      
 
Domain Number 2 Region: 517-656
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.46e-22
Family Family 6 carbohydrate binding module, CBM6 0.0065
Further Details:      
 
Domain Number 3 Region: 281-463
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000103
Family Galacturonase 0.044
Further Details:      
 
Domain Number 4 Region: 698-748
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000177
Family Type I dockerin domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219851070|ref|YP_002465502.1|
Sequence length 749
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MVSSLRVLSLLSLTALLVLFLSSIPGPAEATVKIVPLGDSITKGSTQTADEAQYPTYRYW
LWHSLQDNGYDVDFVGSWDQPRFQDFSFDQDNEGHGGYTTDGILNGASDDPWQGHLSGWL
GSYSPDIALVELGTNDVLHQVPADQSIRNLEAIIDTLRDRNPHVKILVGTVIPTSIYREN
LIALNQRIPEVAADKSTTASPVKIVDLYSGYDGLADNQLPLGVHPNLQGEKKIAAKWYNA
LVPLLDSSTPTPTPTSTPTSTPKPTPTQDSHLITGPVKITVPGTYTLANDITGSSSQVGI
EIASSNVVLEGNEHTISGTGQDGSCGVFVSSSDTPISGVVIRNLKVSNWGYGIYYYQGVT
GGTVTGCEVTGNSFAGVVLYSGGDRTTIRGNTITRNIRGVYLANVDGAGVVDNMLKNQNN
AVFAGTVTSTVWALPVQAGTNIAGGPSLGGNYWGSTAGTGFSDTASDADHDGFSDQQYTV
WGGNVDPLPLVTYVPPTPTPSPTPTPTFTPGPFTSLTVPGTLQAEQYDNGGEGTAYHDTT
PGNQGGEYRQDDVDIESGASGYDLCFIRTGEWVNYTMQVATAGDYTAAFRAASWGDDHTI
TLSIDGTVAGTVVLADTGSSEVYADTAIPVSLPSGTHTLTLEFTGDGENLDYVVFTAVPV
STPTLTPTPTGNQTGTLQPIPPSTLVPTDPNNDGQYEDLNGDGLVDFSDVVIFFNQMDWI
AENEPVAAFDFNQNGQIDFNDVVILFERL
Download sequence
Identical sequences B8GJX5
gi|219851070|ref|YP_002465502.1| 521011.Mpal_0405 WP_012617098.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]