SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851080|ref|YP_002465512.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851080|ref|YP_002465512.1|
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.41e-38
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219851080|ref|YP_002465512.1|
Sequence length 199
Comment beta-lactamase [Methanosphaerula palustris E1-9c]
Sequence
MPVRWIPGRDAQANSYLFGDVLVDAGVLPMAVERYKDQISTIILTHGHYDHTAYLKEIAH
MCSARVCIHTADAEALFRDEISLANHFGEHSPRIAPDQKLQGGEVIGGLLVIPTPGHTAG
SICLYSEEEHLLISGDTVFTDGACGRTDFPTGSAAAMEESLMSLQKLEVEGFYPGHGEPV
DHGGAMQIAAAAVLCRRGW
Download sequence
Identical sequences B8GKA6
gi|219851080|ref|YP_002465512.1| WP_012617108.1.75456 521011.Mpal_0415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]