SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851095|ref|YP_002465527.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851095|ref|YP_002465527.1|
Domain Number 1 Region: 47-330
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 5.49e-25
Family DPP6 N-terminal domain-like 0.023
Further Details:      
 
Domain Number 2 Region: 349-403
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000155
Family Type I dockerin domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219851095|ref|YP_002465527.1|
Sequence length 403
Comment hypothetical protein Mpal_0430 [Methanosphaerula palustris E1-9c]
Sequence
MMKRREGAIRIAILWLVMLCAMVVISPMAGAVEVRIGTSDSDQGHPSISGDRIVWQDDRN
GNWDIYLWNITTQTETRITTDSSDQKNPSISGNLIVWEDYRHGVNPEIYLYDLTTHIERQ
ISWSGDENYQMEPAVDGTNIVYEDSMNGFYNIYLYDLLTQHRHSLNEDSKTQWHPAISGD
DVVWIDYTTSILYLYSISAGGQPIAVTDGYTAPKAPAVDAGRVVWADYVNGNDAGIFLYD
RATGIKKWLTPNPSNQDNPVISGNTVIWVDDQAGTSNLYRYDLTTHQTTRLTSGPSNQYS
VSIDGDRVVYVDDRGMNPHIYMTPIESTPQPVMVNGQTKLPTDPNHDGLYEDLNGNNAID
FNDVVIFFNQMDWISEHEPISLFDFNHDNQIDFNDIVLLFNQL
Download sequence
Identical sequences B8GKC1
WP_012617123.1.75456 521011.Mpal_0430 gi|219851095|ref|YP_002465527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]