SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851276|ref|YP_002465708.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851276|ref|YP_002465708.1|
Domain Number 1 Region: 4-271
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.97e-49
Family ROO N-terminal domain-like 0.0000505
Further Details:      
 
Domain Number 2 Region: 245-390
Classification Level Classification E-value
Superfamily Flavoproteins 1.29e-26
Family Flavodoxin-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219851276|ref|YP_002465708.1|
Sequence length 395
Comment beta-lactamase [Methanosphaerula palustris E1-9c]
Sequence
MTANEIVPGVHAVGTVDWDRRLFDELVPLPHGTSYNAYLVQGSEKVALIDASDPEMELPF
ITNLMKGGVGHIDYVVVNHAEQDHSGLLPLVLELYSDAKVVTNATCKDLLKSFLGIEDEK
IIVIKDGETLSLGDKTLEFLITPWVHWPDTMLTYLREDKILFSCDLFGAHMATSDLFMSD
AREWYTHAKRYYAEIMMPFRNSIKGYLERLKAYPIAIICPSHGPIHDRPETVLEAYADWT
SDEVKNTVVIPYISMHGSTKAMVDFLVRALTERGVGVKQFQLSLTDTGDLAMALVDAATI
VIATPTVLFGPHPKVVYAAYLANILKPKTRFVSVITSYGWGGKTVDTLVGMLNHLKVEVL
EPVTVKGYPTEETQKDLTRLADEIFKKHKESIGVL
Download sequence
Identical sequences B8GFD7
gi|219851276|ref|YP_002465708.1| 521011.Mpal_0614 WP_012617304.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]