SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851333|ref|YP_002465765.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851333|ref|YP_002465765.1|
Domain Number 1 Region: 79-217
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.39e-21
Family Family 6 carbohydrate binding module, CBM6 0.0085
Further Details:      
 
Domain Number 2 Region: 787-875
Classification Level Classification E-value
Superfamily Cupredoxins 3.87e-17
Family Plastocyanin/azurin-like 0.029
Further Details:      
 
Domain Number 3 Region: 315-645
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000000000458
Family Soluble quinoprotein glucose dehydrogenase 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|219851333|ref|YP_002465765.1|
Domain Number - Region: 603-678
Classification Level Classification E-value
Superfamily GroES-like 0.0432
Family Alcohol dehydrogenase-like, N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219851333|ref|YP_002465765.1|
Sequence length 875
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MSTPAPGNVMTGLILRKFIYNKGPSEPPMKRSTIALIAVLCMAMVALTVAAIPTGTSSPS
GNVTSTEHLFHPFTGTPSAIPGMIEAENYDTGGQGIAWFDRTPGNEGGAYRQDDVDIETG
GSGHVVAFVKSSEWLIYTVDVQESGKYLATFHASSPWAEREVWVWVDGVLEAQVKVPDTK
SFDIYEDATANISLTAGSHYIRLQFVGDSQNLDYMALAMAQGSGGTESTPTPTIIPTLTP
TSTPEGNVTPTPTGNVTPTPTSDGGGGNVTPTPTGNVTPTLVTNTTDLTNQNSSEAATST
ANLSTTMLKAPTVPIGLQRIAGNFTSPLFVANPDDGSSRLFLVDQNGYVKIFYMNGTVID
QPFLDVRDRMVNLSSAYDERGLLSIAFHPNFSTNGKVYAYYSAPLRAGADPAWSCTNRLS
EFQVSPDNPNQVNMSSERILLEIDKPYENHNGGILLFGPTDHYLYLTLGDGGGADDTGMG
HTPGIGNSQDLTTLLGKVIRIDVDTTSPGKEYGIPADNPFLSNATIRPEIYAYGFRNPAF
ATFDSGGSNRMFIAMAGQNLFESAQVIYKGGAYPWNIREGTHSFDPANDTEVPNTSSRIT
SYSGQPLIGPVVELGHDVGNVIVGGIVYRGSILSSLQGSYIFGTWSNSFSTGNGTLLVAT
PPAGLDLTTLPDDAANLTAAENTMWTTSEMTVANNANGRINAFIRGMYENADHEVLVLIN
QNGGPGITPQNSGEVWKMVPANTSGLVPIGNASAESTPTTTTTVTTTSVTTTATTPASLN
TSINLTAQNLAFNQSTITVPAGAQVTVTFNNMDSGMPHNFALYTDSSAATTIFKGSVITG
PATTTYTFTAPSTPGTYFFRCDVHPTLMFGQFIVQ
Download sequence
Identical sequences B8GFJ4
521011.Mpal_0675 gi|219851333|ref|YP_002465765.1| WP_012617361.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]