SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851381|ref|YP_002465813.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851381|ref|YP_002465813.1|
Domain Number 1 Region: 1-232
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 6.3e-22
Family Pce catalytic domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219851381|ref|YP_002465813.1|
Sequence length 255
Comment beta-lactamase domain-containing protein [Methanosphaerula palustris E1-9c]
Sequence
MKILHVRHATSLLTYAGSRILTDPVFSEKEQYPPIPLTPNRRRNPLVDLNTPMDKLLDVD
MVLSTHTHGDHFDDRARELLDKKIELICQPEDVKTLGSSGFQNIIPVDESITIRNIEITR
VKAHHGTGVTGEIMGPSSGYILSSKNEPTLYITGDTVFHESISETIEKFHPDILIINAGS
PKFLNSSHIVMNIIDVEETLRIDPNLTFIIVHLDTFNHCIETREDLHEYFTPARLAEIGV
KKFFIPEDNELLEFS
Download sequence
Identical sequences B8GG16
gi|219851381|ref|YP_002465813.1| 521011.Mpal_0725 WP_012617409.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]