SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851391|ref|YP_002465823.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851391|ref|YP_002465823.1|
Domain Number 1 Region: 247-296
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000186
Family Type I dockerin domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219851391|ref|YP_002465823.1|
Sequence length 298
Comment hypothetical protein Mpal_0736 [Methanosphaerula palustris E1-9c]
Sequence
MRSTNTLLILALLLMLVLPAAAAQTTDLTVIRYGWDNKTVEESQTVNVSWMENSLPVFGD
GVTPYLLQGPILNITNYSDPAKWNIAEDTNIDKVNETIRGTRLIDLCNLVGGMHPGDLVR
IRASDGFTKTFPYKNVYTPQPRQGPIILAWWTARQGYSYSDGIRLFFGADNSTNPWGLHI
FGNQDMKEAFDEDYWSWFGGKDALPSAAQISCKWIAKVEILPAPRALAVPGSSKVPTDID
GDGLCEDINGDGVLDFNDVVLYFNQMDWIADNEPISLFDYNGNGEIDFNDVVWLFTRV
Download sequence
Identical sequences B8GG26
521011.Mpal_0736 gi|219851391|ref|YP_002465823.1| WP_012617419.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]