SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851394|ref|YP_002465826.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851394|ref|YP_002465826.1|
Domain Number 1 Region: 683-765
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000981
Family PKD domain 0.0024
Further Details:      
 
Domain Number 2 Region: 533-662
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 0.00000000000123
Family Oxidoreductase molybdopterin-binding domain 0.0075
Further Details:      
 
Domain Number 3 Region: 792-876
Classification Level Classification E-value
Superfamily PKD domain 0.0000157
Family PKD domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219851394|ref|YP_002465826.1|
Sequence length 877
Comment PKD domain-containing protein [Methanosphaerula palustris E1-9c]
Sequence
MRSTYALLLLVLVLVLAAPVAAAQTTDVQVIHYAGDGTTVANQETVNVSWMESNLPVFGD
GATPYLLQGPMLNITNYSDPAKWNPAEDTNIDKVDEMIKGTKLVDLCNLVGGMHPGDEVK
IIASDGFTKTFPYENVYNPQARQGPMVLAWWTARQGYDYSDGIRLFFGADTSTNPWGLHV
YGNQDMKNTLDEKYWAWYGGTDALPNAAQLSNKWIAKVEIVPTSSSNWTNATTVTPTPTA
TLNWTNTTTVTPTPTATQTSGPVVLFDGNLTLTDGTFPGYAYNSGATHQVQNLTPHGALE
LASKAANFTYDATDKKWSTLGTFMLDNAGGFNYDNSAAKKAWAYRVNGVWKNDFSSSEGI
STYRLNDGDLVEYYYGVNGGAFKDAEAVIRIRISIREPTTIFDGSVTLMNGTFPFYAYNS
GTTHNVGNLTVQGALEATAEKGGFTYIATDKKWNDLGTVLLDGVSTYNKTQNLTWAYTQN
GVVMNDFSANQGISVQQVKNGDNLVFYYGVKGASLDAATAVVRIRVFVANDVNFTLTLNG
AQSATFSKADFEASGNRVEYTDISGTWSGIPLWRLVGLVDDGDPATFNDTLAAQNYQVKI
TGSDGFNQSLNSSLIARNNNCIVVDRLNGVPLDETGWPLRLVGPSIPSYLSVRMITTIDL
IGLTPEKPTVTPTSPTLTPTPTVPPTIGDYPVPDFTLTTPSPMEIMIIDNTTNATSIRYD
LGDGTSTAYRNFRYYYWAPGTYTITLTATNAVGTSVKTVSITVPATTPTVTATTTVPTPT
PSVTPTEPVTGASFSGIPQATSYGEAIKFTVTPAAGKTIRSTWWTFDRVNHYGTWNSRDI
NPTFFYPAKGTYTPLVKITYTDGSTDTVELANYITVQ
Download sequence
Identical sequences B8GG29
gi|219851394|ref|YP_002465826.1| WP_012617422.1.75456 521011.Mpal_0739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]