SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851408|ref|YP_002465840.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851408|ref|YP_002465840.1|
Domain Number 1 Region: 13-317
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.77e-52
Family SGL-like 0.042
Further Details:      
 
Domain Number 2 Region: 375-523
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.07e-23
Family Family 6 carbohydrate binding module, CBM6 0.0079
Further Details:      
 
Weak hits

Sequence:  gi|219851408|ref|YP_002465840.1|
Domain Number - Region: 542-624
Classification Level Classification E-value
Superfamily PKD domain 0.00279
Family PKD domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219851408|ref|YP_002465840.1|
Sequence length 627
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MYYSRLMKPVSFLILLVLLCAVIHTVSAEEMYVFTGTWGTNGSGDGQFNYPQGIAVDGAG
NIYVADNGNKQVQKFTSSGTFVTAWGTAGPEDDRFSEPSGIAVDSEGNVYVTDTGKFRVQ
KFTPTGTLITEWGTEGTGDGQFYSPNAVAVDGEGSVYVTDIRYSGSGPRIQKFTSNGTFV
TKWMTYGDEVMYSQPMGIAADSAGSVYVVDLRRDRILKFTSTGTLLSEWGTTGSGDGQFN
NPMGIAVDSEGYVYVTEPYANRVQKFTPNGTFVTNWGTEGSGNGQFNNPRGIAVDSAGTV
YVVDSNNHRVQIFEQGTTPSLTPTVPPTSTPTMIATPTSTPDGNDTPIATLTTTTFTPSP
TVISVTPQTTPYGAGNTIPGRIEAENFDTSGTGAADASYADTTPANEGGAYRPSESVDIE
YTAGIGSYDVGWIRAGEYLIYTVQVANTGQYTAQFNAANPDAWSKAVDVYVDGTKFGTVP
IGSTGSFTTFTTFAFPISLPAGRHQIKLAFPSDRLNLDYIEFAQGDTPVTTATTPSPTTG
SATFIAVPASAPHGSAFMFSVTPSPGKFISSAWWSFDYPAHWNTWNSREVDPTFFYPWAG
TYSPHVKLTYTDGTTEEVTRGNYITST
Download sequence
Identical sequences B8GG43
WP_012617436.1.75456 gi|219851408|ref|YP_002465840.1| 521011.Mpal_0755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]