SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851430|ref|YP_002465862.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851430|ref|YP_002465862.1|
Domain Number 1 Region: 178-628
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 8.78e-131
Family beta-CASP RNA-metabolising hydrolases 0.00000274
Further Details:      
 
Domain Number 2 Region: 88-134
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.0000105
Family Prokaryotic type KH domain (KH-domain type II) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219851430|ref|YP_002465862.1|
Sequence length 630
Comment beta-lactamase [Methanosphaerula palustris E1-9c]
Sequence
MVIEERLKELRDKINEKVPAGITVSQVEFEGPELAIYTDDPKRFADEADLIRILARDLRK
RIVIRPTILEEPEKAVNDIKSVVPEGAGITDIFFDADTGEVLIEAEKPGVVIGKNGATLR
EITKAIGWTPKVVRTPPIESTTVKQVRQFMRSVNDERKDFLRTIGRRIHREITNKDQWVR
VTTLGCCREVGRAAFLLSTPESKVLIDCGEKPDNNNNGTPYLYVPEIHPLSQLDAVVLTH
AHLDHCALIPLLYKYGYEGPVYSTPPTRDLASMLQLDYLEVIRKEDKKIPYTSADVKSYL
KHSIVLNYGSVTDIAPDIKLTFHNAGHILGSAIAHFHLGDGLYNIAFTGDFNYGKSRLFN
PAVSTFPRLEALFMESTYGGANDMQPARKDAEEKLYETVNKVLERSGKVIIPAFAVGRSQ
EVMLALEEGMRLGKIPNVKIYLDGMIKEATAIHTTYPEYLNSDLRNLIFREGLNPFLAEC
FVQVDSNELREKVVLGDPCVIITTSGMMNGGPVMEYLHNLAGDEKNALVFVGYQADGTLG
RRIQKGWREVPLGRRETIVINLEIVTVDGFSGHSDRRQLMNFVGHVQPHPEKIFTIHGDE
NKTIDLASSIYKRYHIETHSPMNLETYRMI
Download sequence
Identical sequences B8GG65
WP_012617458.1.75456 gi|219851430|ref|YP_002465862.1| 521011.Mpal_0777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]