SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851486|ref|YP_002465918.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851486|ref|YP_002465918.1|
Domain Number 1 Region: 93-380
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.3e-40
Family iota-carrageenase 0.05
Further Details:      
 
Weak hits

Sequence:  gi|219851486|ref|YP_002465918.1|
Domain Number - Region: 371-438
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0196
Family Galacturonase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219851486|ref|YP_002465918.1|
Sequence length 451
Comment hypothetical protein Mpal_0833 [Methanosphaerula palustris E1-9c]
Sequence
MDGHSRSIILVAVMFILIAVGFSTVSVIIDVPQFLSEHIENVDNPITMGSLFTTVEAVTK
ANTAYTMGNTRLAQMQQAYQAWAVPSRPDLVKIATNVRSSGLKGDGVTDDTAALQSLLTK
LPSGSTIYFPPGQYRIDGPIRINKPVTLFGESGTVFDCQRATQYVFTLNAKGSSASRLKG
VTITGIVFEGPGIETDPAMIDAYYLQTFHVSYVKFHNIGYAAIRVNTCTDVTIEESIFDN
VFQSGLGYGVSITDHSDRIYIHDNFFVTKGRHSITTGTSNTNLPEAEYVQSVTVENNYFE
NTTEQAVDAHKPTAGPYIVKGNVMNNCAQGVDLGNGSAEITDNVMINCKSGIVLTNMNVD
PDNLGPKVDRIVDNTMINILYEAIDVDRTNILIQGNIAKGTKSGSGIIIAEYSPDSCKIV
GNILDDFNRGIQIGIPGPGISLENNAEISTQ
Download sequence
Identical sequences B8GGE0
gi|219851486|ref|YP_002465918.1| 521011.Mpal_0833 WP_012617514.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]