SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851493|ref|YP_002465925.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851493|ref|YP_002465925.1|
Domain Number 1 Region: 41-305
Classification Level Classification E-value
Superfamily NHL repeat 7.85e-48
Family NHL repeat 0.0000215
Further Details:      
 
Domain Number 2 Region: 337-390
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000235
Family Type I dockerin domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219851493|ref|YP_002465925.1|
Sequence length 390
Comment NHL repeat containing protein [Methanosphaerula palustris E1-9c]
Sequence
MGHVFSTTCVLVLVCCGVLVAAVSGEYVYSAQWGSSGAGIGQFDHPGGVAVDSAGNVYVA
DTENDRIQKFTSSGTFVTVWGSSGTGIGQFAHPDGVAVDGAGAVYVADTENDRIQKFTSS
GSFLGGWGSSGSGAGQFNAPTSLAVDGVGSIYVVDSWNDRVQKFTSSGSFLAAWGSHGSG
VGEFDEPFGIAVDGTGNVYVADTYNNRVQKFTSAGLFVSTWGTSGTGTGQFNWPWGVAVD
SAGAVYVTDVWNNRIQKFTSAGLFVSTWGTSGTGPGQFTWPYGITIDGVGQVYVTDEWNN
RIEVFVSSGEPTPTPVLVTVIPGGVGVPTSPDNDGLFWDLNGDQRVDFNDVVLYFNQMDW
VADNEPIKAFDFNKNGVINFDDIVLLFNRL
Download sequence
Identical sequences B8GGE7
521011.Mpal_0840 WP_012617521.1.75456 gi|219851493|ref|YP_002465925.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]