SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851510|ref|YP_002465942.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851510|ref|YP_002465942.1|
Domain Number 1 Region: 178-375
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-33
Family Kelch motif 0.013
Further Details:      
 
Domain Number 2 Region: 72-232
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-20
Family Kelch motif 0.015
Further Details:      
 
Domain Number 3 Region: 29-80
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000129
Family PKD domain 0.0037
Further Details:      
 
Domain Number 4 Region: 375-415
Classification Level Classification E-value
Superfamily PKD domain 0.000000314
Family PKD domain 0.004
Further Details:      
 
Domain Number 5 Region: 434-488
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000139
Family Type I dockerin domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219851510|ref|YP_002465942.1|
Sequence length 488
Comment PKD domain-containing protein [Methanosphaerula palustris E1-9c]
Sequence
MIYHPKNMPLMTACLLITVLLLLVGTVSAAGAPTAAFSSTPINGTVPLTVNFTDTSTGSP
TGWSWFFGDETYTQPWTQQNAHSGWSERFSHSSVVMPDGSIVLMGGYSNESRAILNDTWR
SIDNGATWTLMNASSGWPARAGLSSVAMPDGSIVLMGGGNESTYMNDTWRSTDDGATWTL
MNANSGWSGRFYHSSVAMPDGSIVLAGGRDESGNLTNDTWRSTDDGKTWTLMNPNSGWSE
RDCQTAVAMPDGSIVLMGGWDDTTPLNDVWRSTDNGRTWTLVNASSGWSARYSHSSVVMP
DGSIVLMGGLNDTALLNDLWRSTDKGETWAQVQNAGWSGRFHHTSVAMPDGSIVLMGGLD
DSTIRNDTWRLQPAGSSQQSPSHTYTTVGIYSATLQAFNAAGFSSTQKVSAIVSPMQPVP
PSVTAPRDLNNDGLYEDIDGNGVLNFNDVVLFFNQMDWIADNEPVRAFDFNRNGRIDFDD
VVIVFNAL
Download sequence
Identical sequences B8GGG4
gi|219851510|ref|YP_002465942.1| WP_012617538.1.75456 521011.Mpal_0859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]