SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851541|ref|YP_002465973.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851541|ref|YP_002465973.1|
Domain Number 1 Region: 9-366
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.14e-21
Family Galacturonase 0.051
Further Details:      
 
Domain Number 2 Region: 381-432
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000145
Family Type I dockerin domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219851541|ref|YP_002465973.1|
Sequence length 433
Comment periplasmic copper-binding protein [Methanosphaerula palustris E1-9c]
Sequence
MSSYTFIVLLAALVLLLASGGVLAADPTTAAGEPIPITGCTEITNPGTYYLASDLIDLGC
ETAISVRCSNVVIDGRNHHVEGNDSPATVGIDIRSQQGNPGITNVLVENIQLSGWDQGVV
VSPAGGEASPPPYVRLNNVHSQNNTEGFDLWGPGTITLDGCTATSNLQKGIRADGIEGDL
AVALTDVQIQANGDDGVYARLTGMTINNCQISFNGWRTAESSGFRLNKGSAIIRDSLFEQ
NRGAGIFFETATNGTVTGTKIQYNGVGIRDSSGDGTVNIYNNYFRNDRNVALEGQVDTWS
VQKRVGPNIVGGPSIGGNYWASPNWTGFSEMHLDVDGDGFCDEQFVIDGGNVDHLPLAMP
PAIVPGGTGIPTSTKQDGRFDDVNGNGVLDFNDVILLFNQMDWIRENEPVAGFDFNGDGQ
ITFADVVWLYGML
Download sequence
Identical sequences B8GGJ5
WP_012617569.1.75456 521011.Mpal_0894 gi|219851541|ref|YP_002465973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]