SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851552|ref|YP_002465984.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851552|ref|YP_002465984.1|
Domain Number 1 Region: 703-844
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.31e-31
Family Family 6 carbohydrate binding module, CBM6 0.0027
Further Details:      
 
Domain Number 2 Region: 301-401
Classification Level Classification E-value
Superfamily PKD domain 3.53e-26
Family PKD domain 0.00041
Further Details:      
 
Domain Number 3 Region: 400-484
Classification Level Classification E-value
Superfamily PKD domain 2.22e-23
Family PKD domain 0.00044
Further Details:      
 
Domain Number 4 Region: 487-566
Classification Level Classification E-value
Superfamily PKD domain 5.89e-16
Family PKD domain 0.001
Further Details:      
 
Domain Number 5 Region: 569-670
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000536
Family PKD domain 0.0041
Further Details:      
 
Domain Number 6 Region: 225-324
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000379
Family Pre-dockerin domain 0.066
Further Details:      
 
Weak hits

Sequence:  gi|219851552|ref|YP_002465984.1|
Domain Number - Region: 136-202
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00235
Family Carboxypeptidase regulatory domain 0.031
Further Details:      
 
Domain Number - Region: 39-111
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0576
Family Carboxypeptidase regulatory domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219851552|ref|YP_002465984.1|
Sequence length 845
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MTLIHRRMTWPLLMLAIISCLLMIAPASAESFHLTGTLINGSINGNTNQPIANTNVTFQI
NSPFFQGTINGTTETDNLGNFDLSFDPGIGIPPFISITCSATTIGYSVYQSQAPIIVMVG
YANIGSIYLTPLPVPITLTGTVVDKFSGLPVPNMQIDSGSASDTSKQDGSFTLFEAPETG
GSMDFEIYADRYYEGHQDTLSVSEEEIARGSKDLGTVTITPHYGGYVTDKSTGQPLSGVQ
LTITNDPSSQVGNGGTGTSDETGYYRIRLPAKGISSNNSLRDTGADNSVRYLVAVKDGYQ
LYSANVTIRDEEAPFNVALSPSFAANFLALGHVGQAPYSVRFMDQSTGSPTAWKWDFGDG
TTSTEQNPTHIYNQTGVYNVALTASNDKTSDTCTQYRCIIVNAVPVANFTANVTAGQTPF
TVQFTDQSTSGADGFQWQFGDGTTSTEQNPVHTYTSPGSYSVMLTVSVPDYGSVFAQKTG
YISVSGPSSVGFTANVTAGLSPLAVQFNESTNESVQYSFWHFGDGATSAEKSPVHVYDAA
GSYSVSLMTVGSNGTEVKTVDNFINVSAPVTPTVTPTATATATVTPTPTGALPVANFTVT
TGAPGSSDITVTDASTNATSVHYSLGDGATTAYPTFRYTYWQAGTYTIEQTATNAVGSSK
KSIVVTVPVAAPTTTVTPTVTVTTTVSPTVTTTSQAYNGPHTIPGKLQAEDYDLGGEGVA
YYDTTPGNEGGVYRHDDVDIEQLDTDGSPNVGWIRSGEWMAYTVNVASTGTYTAGFRVAS
SHSGSSIKVYVDDGTTPVATVNVPNTGDWPSFQTVSVPVTLPAGQHRLKFSFPTDYVNIN
WVTFA
Download sequence
Identical sequences B8GGK6
gi|219851552|ref|YP_002465984.1| WP_012617580.1.75456 521011.Mpal_0907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]