SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851579|ref|YP_002466011.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851579|ref|YP_002466011.1|
Domain Number 1 Region: 246-421
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.44e-25
Family Zn metallo-beta-lactamase 0.067
Further Details:      
 
Domain Number 2 Region: 4-67
Classification Level Classification E-value
Superfamily ACT-like 0.000000825
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219851579|ref|YP_002466011.1|
Sequence length 506
Comment beta-lactamase [Methanosphaerula palustris E1-9c]
Sequence
MEREERFSFIARVPDEPGALHRVAAIITEFGLNITRTQYDQRIDRETVFFEVIGDAGQYR
QVLDHLNLAGLLQTSLPKIRILKLYVYLPHQAGALSSFLDLVRQGGANIFFIDFDERGRH
PERVTISLNLDQNGVVDDLLGQLSSAYKLEVVEYDPTGHHLDDTIFYVRFAQRVRELIGD
GADDSFLLQFLHDINHTVQELMNRGRDPQEVFANVLSAGQTLHKTSKEGFYSDIQQIQVS
DLVTLFCFQMPCGGNVFLFKTGDELVLVDTGFGIYHDDIVQMLARYGFTDLSKLTRIIIT
HADADHCGGSGLFPVPCYMHPGTLEVIRQANRAYGSRSEGSVLEEVYTTMINLFSRFAIP
EDVHLFSSEPQGMVGPFPIVGEVTIGDLQFLVLEGLGGHMYAQTYLFCREAGLFFAADCV
INFDSLTQARRDYSTLAVLLVTSVNVDSDLARTERKAVVQILNDLNHTRGQEERPCLICG
GHGAVSVLDHGRLVPYGTVTHYAAKE
Download sequence
Identical sequences B8GGN3
gi|219851579|ref|YP_002466011.1| 521011.Mpal_0936 WP_012617607.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]