SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851647|ref|YP_002466079.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851647|ref|YP_002466079.1|
Domain Number 1 Region: 112-341
Classification Level Classification E-value
Superfamily Cysteine proteinases 2e-24
Family Papain-like 0.0087
Further Details:      
 
Domain Number 2 Region: 402-591
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000267
Family Pectate lyase-like 0.052
Further Details:      
 
Domain Number 3 Region: 644-697
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000432
Family Type I dockerin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219851647|ref|YP_002466079.1|
Sequence length 698
Comment periplasmic copper-binding protein [Methanosphaerula palustris E1-9c]
Sequence
MFSYPSIRYLTLLIIICCGLLIIPVAAETANESLKMPAFFSDIQNRGVDLPATDETPVHT
VMHPSSEQLKAWNTQYNALPLVSVPATSSSSQLQNNTTSVSGYKDLLPYLDYTPAERDQG
RIGNCWVWAGTAVMEIAHAVQNGVKDRLSISYLDANYNGGSGNAWAGNGGYISTVADFYS
GTGIAVPWSNQNAEYQDGTKWSATEQRSYEPAFAISTEPYYQIDQIKTERIETRHVGDEQ
AINNIKAVLDQNRAVDIMFYLPNTTAWDSFDDFWDNSSEETVWNMTPWQNTFWNNTEGGG
HAVVCVGYNDTDPANRYWIMVNSWGVSKGHPRGVFRVSMDMDYSATVQFKDSDDSAAQLW
QTLNVSFASTPSPSPKEISSLPYTCSVPGEYYLSKDLISSDADTGILVTAQNVTIDGKGH
LLRGSGQQGSVGILAYNNGDPVDGLNITNLAISNWEDGCYLYHATDGSVNDTTISDCSYA
GIFLDGGTAGLAIADNTLTANYYGLLSRSTADIRIEHNRITQNQNAGLDLISMNQSLIAD
NQFINKINLALPTGVTTIAWNTSKTTGQNLAGGPYLGGNYWGNPTQTGFSDLAADQNRDG
FADSPNQIGAGNIDQLPLVAYANPGPQPIPPNQLAPTDPDHDRLYEDLNGNGKFDFGDVT
TFFNQIDWIADHEPVQLFDFDGNQRIDFGDIASLFSRL
Download sequence
Identical sequences B8GGV1
WP_012617675.1.75456 gi|219851647|ref|YP_002466079.1| 521011.Mpal_1008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]