SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851676|ref|YP_002466108.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851676|ref|YP_002466108.1|
Domain Number 1 Region: 30-285
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.13e-27
Family Galacturonase 0.064
Further Details:      
 
Domain Number 2 Region: 325-611
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.13e-22
Family Proline iminopeptidase-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219851676|ref|YP_002466108.1|
Sequence length 614
Comment alpha/beta hydrolase [Methanosphaerula palustris E1-9c]
Sequence
MNDMFLSGPSMGLLILVFCLLVVPAAGQGDGPLMITAPGQYILDHDPVGGGQQGIVISSS
DVLLDGGGYQVVGTSSQGSVGVVVKGAQQNVTIRNLSVRSWGTGIRFQSISSGRINGVTA
VNCTENGFLLDGCSGISIDSCQALQNGLPGIAINESTKCRLTETQTLQNGDVGMYLLNAT
GTIIDRCTASENRLNGIFLEQSDKTTINNCQAAWNQYPGIAISGGMQNMITTNLLYGNQI
AAVYLEETGRTLVLNNAAGGSPAGLSIVNCTDRVIAGGNRWLTDEQTLVTEARNVSPVPA
LGPSPNHLHALVALDRASGASVRTGHRVDVGDGRRIALQTSGIGGPVVVMEAGTGDSALS
WAQVQQEVGEFTTAVSVDRAGLGWSDPRTGPANATADVSDLHLALHNAGLPPPYLLIGQG
RGATIMRLFTHRYPAEVAGLVLVEPEVENEFSSNADYSMVRHQQITDLVLALEKRVGAVD
SGYLARNPGLVTVSPHLSLQDQQTDRALIVSHPAFTLAQIDEWKGTDRFFTTVRSELNGM
HLGVPVRILLSTDPALQTEGSGSVPEGYRTFRNLQRGLVGNSADGQVMTIQNTTRSLQLD
RPDAVTDAIRQLVG
Download sequence
Identical sequences B8GGY0
521011.Mpal_1037 gi|219851676|ref|YP_002466108.1| WP_012617704.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]