SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851812|ref|YP_002466244.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851812|ref|YP_002466244.1|
Domain Number 1 Region: 6-172
Classification Level Classification E-value
Superfamily Flavoproteins 3.49e-44
Family NADPH-dependent FMN reductase 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219851812|ref|YP_002466244.1|
Sequence length 183
Comment NADPH-dependent FMN reductase [Methanosphaerula palustris E1-9c]
Sequence
MSRYQIAVIIGSLRKDSFNRKLANAIVKLAPPEFSFKQVQIGDLPLYNQDDDGNQAESVK
RLKDEISAAQGLLFVTPEYNRSIPGVLKNAIDHASRPHGQNVWAGKPAGILGASTGAVGT
ALVQQHLRNVLAHLDVPTLGQPEAFIQVRDGLFDEVGNIGEGSRHFLQNWMDHYVAWVKK
IAA
Download sequence
Identical sequences B8GHB6
WP_012617840.1.75456 gi|219851812|ref|YP_002466244.1| 521011.Mpal_1180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]