SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851966|ref|YP_002466398.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851966|ref|YP_002466398.1|
Domain Number 1 Region: 582-722
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.83e-25
Family Family 6 carbohydrate binding module, CBM6 0.0028
Further Details:      
 
Domain Number 2 Region: 247-302,337-572
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.51e-21
Family Pectate transeliminase 0.092
Further Details:      
 
Domain Number 3 Region: 65-209
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-17
Family Family 6 carbohydrate binding module, CBM6 0.0065
Further Details:      
 
Domain Number 4 Region: 752-806
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000667
Family Type I dockerin domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219851966|ref|YP_002466398.1|
Sequence length 919
Comment periplasmic copper-binding protein [Methanosphaerula palustris E1-9c]
Sequence
MDQISSTRRRPCALAPAVILLLVLCLLAGGAQAATDPMDTAANATIEPTPVQVPAAKVLA
PYSGIHTVPGQVQAEDYDLGGEGIAYHDTTPGNEGGVYRQDDVDIETAGGITDIGWIRSG
EWLAYTVNTTTPQTVVLRLSAANPDATIKRVTISTNGTTAGTIDLRPTGSFNTFLIHDST
PFSLPAGATTVRLLFDGIARVNLDYLDFELPATQEPTPVPTPTPELLISTPGLHTLGGDL
SADGIGVLITSSDVILDGMGHSIVGTSANGSIGVYATSLATPTSSGPITNVTVRNLSVRH
WDEGIQVGEASETVVEEVVAEQNRIGLSYGPQGGITHDHVVRNSVLRENTNLGLDLSYPA
GGFAVERCSITGNSVGINADMVRSSERTTNHLADCDVSENAGDGLTSKDGSFVVVQNCTF
RANGGNGLEFEHGGAEIVGNHIEENAGDGVHASDRGGSNIHGNWITGNGRGIVVGGDWGS
RVRNNYLNNTNNGFFGAVEAGMMNYEKTGGANIVGGPYLGGNFWASPNGTGFSETHPDAD
HDGICDVPYVVNAEDGVTDFLPLAPSPGTPVIAPAPYTQHLVPGRIEAEDYDLGGEEIAY
HDTTPGNTGGAYRQDDVDIETTGGITYVGGIQDGEWLIYTLNVPEGGAYLMTARVATPNE
GLMARISVNSETMFALIRFPETGSFTTYTTVEAKYIYLPAGNTTVRLTFQGDGLNLDWIA
FSPQDIVTPTPKPLVAVPGGAGTPSDTNADGKYDDVNGDGRSDFNDVVLFFNQMDWIAEN
EPVAGFDFSGNGQIDFNDVVWLFNNFDAPPVRTYNVTAVAIGPGTITPSGRISVPEGENV
TFIMTHENAMPTPYSTQSGYGSGNLVLVDPAMTPTPFPEPEPGAPWVPNPSTFTPSYTLY
DVRSDHTVYSSFYYVMIVA
Download sequence
Identical sequences B8GHS0
gi|219851966|ref|YP_002466398.1| WP_012617994.1.75456 521011.Mpal_1342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]