SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851969|ref|YP_002466401.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851969|ref|YP_002466401.1|
Domain Number 1 Region: 314-601
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 3.99e-55
Family SGL-like 0.03
Further Details:      
 
Domain Number 2 Region: 41-268
Classification Level Classification E-value
Superfamily NHL repeat 1.26e-47
Family NHL repeat 0.0000414
Further Details:      
 
Domain Number 3 Region: 625-674
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000186
Family Type I dockerin domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219851969|ref|YP_002466401.1|
Sequence length 676
Comment NHL repeat containing protein [Methanosphaerula palustris E1-9c]
Sequence
MRSSYFLYIFCILLLCCSVQVVWAEGGYVYTTQWGSSGSGDGQFNQPSGVAVDSDGNIYV
VDTNNFRIQKFNATGGFTTQWGGSGPGDGQFNNPEGVAVDNNGNVYIADRDNNRIQKFNS
SGGFLMKWGSIGSGDGQFNQPSGVALDSAGNVYVTDKQNNRIQKFNSSGGFLMKWGSEGS
GDGQVHWPSGVAVDNTGSVYVVDSYNHRIQKFNATGGFITKWGSEGTGDGQFKSPTGVAV
DSVNNVYVVDTGNDRIQKFNSSGGFITTGGSFGHGDGQFWSPEGITADSANNVYVVDTLN
DRIQKFNATGGFITKWGSALGSFDGQFSGLSDVAVDSTGNVYVAESGNCRIQKFNATGGF
ITKWGSEGSGDGQFNGPTGIAVDSADNVYVVEIWNCRIQKFNSTGGFLMKWGSYGSGDGQ
FNKPSGIAVDSAGNIYVTDANKCQVQKFDQNGTFVTQWGSFGTGDEQFFYPNDITVDNAG
NVYVVDSDNPRIQKFNSTGGFITKWDSFSTGNGQFNRPCGVAVDSAGNVYVTCFQILYTC
GPPELIQSRVQKFTPNGTFITEWGSLGSGDGQFNRPSGVAVDSAGNVYVADSGNNRIQKF
ALVITPVPPSGNTPLDLNHDGLYEDINGDGIADFNDVVLFFNQMDWIAENEPISAFDFNR
NGQIDFNDIVMLFNEQ
Download sequence
Identical sequences B8GHS3
WP_012617997.1.75456 521011.Mpal_1345 gi|219851969|ref|YP_002466401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]