SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852007|ref|YP_002466439.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852007|ref|YP_002466439.1|
Domain Number 1 Region: 32-336
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000272
Family Galacturonase 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852007|ref|YP_002466439.1|
Sequence length 494
Comment hypothetical protein Mpal_1386 [Methanosphaerula palustris E1-9c]
Sequence
MTIIISQKNCPVPEKNNADIVLDGETDFAKIAAEAGKPDRCIKILAGTLNGNGGFAPDGS
RYLRPGPGVTIMGAGPGQTIIEAAGSPCRIEIPETSPGVTLGGFSGVGYFGIQNYASRFT
CEDVEIAHTLDGRTYLPFGKAGGCTAAFMNWGRDGQVLSDLVYRRCTARMAYHHGFSCNT
TGAGAATFQRVTFEECQAIACGSGQEGDGVRDWSCGFDLIDTGHLLGLTVRKCRAFDSWQ
SGFHTDGSWEGHEQRTADLLFEDCVSEGNGQRSGTTPAELYQCGYYLQDHVTLNRCQAKG
NRKAGYLFKNERPKSVVLASCSDDGSAYGLVIEYGGVGIIARQFVSTGATRRALQATAID
ADLEIGIVNFAGDGRPVLLGITERLDFVDAPAHAADLARYRAIGRPFSRSLILEVPASVP
ISDLVEVHPPSASAVDLSGVTVRVREDFGPRPPVPPAPVVTAGPISGGVVSLTMADGEVE
VYELVRQAGVNRRG
Download sequence
Identical sequences B8GHX6
gi|219852007|ref|YP_002466439.1| 521011.Mpal_1386 WP_012618035.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]