SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852010|ref|YP_002466442.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852010|ref|YP_002466442.1|
Domain Number 1 Region: 18-301
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 5.56e-48
Family SGL-like 0.016
Further Details:      
 
Domain Number 2 Region: 346-614
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.09e-20
Family Chondroitinase B 0.062
Further Details:      
 
Domain Number 3 Region: 658-708
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000167
Family Type I dockerin domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852010|ref|YP_002466442.1|
Sequence length 709
Comment periplasmic copper-binding protein [Methanosphaerula palustris E1-9c]
Sequence
MKLKLLICAILLLCGVIQVVTATETYQFTTQWGGNGSESGQFSAPSGITVDELGNIFVAD
TNNNRIQKFSSTGAFINAWGSKGIENGQFKSPRGIAVDKTGNIFIADTGNYRIQKFSSTG
QFLIKWGSPGIGIGQFAAPEGICVDDAGNVYVTDWGYNRVQKFSSDGTYITSWGRGYMSS
PFGIDVDNTGNVYVADTANHRILKFTDDGSLIDTWGVTPGPWDGHFVAPYGVTVDDAGNV
FVTDTYNSRIQKFSSVGTFITKWGTGGTGEGQFGLPSATAIDTSENVYVADTANNRIQKF
TSQGTAPTITQTTSTPTSTATPTQTPTSTPSPTLTTNPRDITAPRTINEPGEYHLVNDIS
NCSTDCIVISGSDIIIEGDGHSISGIGFIPPGADPRILSAGIKIGSSQPVHNIVIRNITV
VNFGLGAYVNQLTDGVIENCSFSHGYVGTIFTYTTNLIIKKCHYSDNSEVGIDLEYYSHD
CFIDNNSIDRDRIGVSLHESGGHHLVSNNTITNNRYGICTWFTGEGMKSWQNTIINNHIE
GNDVGIDGAKDYVITNNYLNNSKNIDHILSPNRWNSTPVSGENIVQGSALGGNYWGQPDG
NGFSQTAVDNDRDGFADTSFIIASQNTDYYPLSLPVIRVVPGSRNPPKALNGDGLNNDVN
GNGGLDFNDVVLFFNNMDWIAANEPVSAFDFNRNGQIDFNDVVLLFNQI
Download sequence
Identical sequences B8GHX9
gi|219852010|ref|YP_002466442.1| WP_012618038.1.75456 521011.Mpal_1389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]