SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852050|ref|YP_002466482.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852050|ref|YP_002466482.1|
Domain Number 1 Region: 452-545
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000147
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852050|ref|YP_002466482.1|
Sequence length 567
Comment sulfate transporter [Methanosphaerula palustris E1-9c]
Sequence
MPQSEEIVKKIKKFPVLLGILPIKRSQVPLDSIAGISLAALAIPEVMGYAKIAGMPIVSG
LYTLLIPLALFAIFGSSRHLVVGADSATAAILATALVTMALPGSSQYSALAGMVALLAAG
FLILSRIFKLGFIADFLSRSVLIGFLTGVGIQVALSQIPGMFGVPNEVQNPILQLAHMVA
TEIPQMNGITIILSILVLVIIMGGNRVMKKLPWAFLVVIGTIVTSWALNLTSLGVATIGT
VPGGFPLIAFPAVPLDQVPNLLGVAAACFIVILAQSAATSRAYAVRYEEKFDENVDLVGL
SLSNLAAGLSGSFVINGSPTKTEMVDNAGGRSQLAQIVTAGVVLIVLLFVTAPLSYLPSA
VLASIVFTIGVNLIDLNGLRNLLYRRPVEFMVALITALTVIFISVGWGIALAVVLSIIAH
LRHSYRPLNFLLVESPDRGWALTSIQSRRQAAPGLAVYHFGANLYYANEARFTSDILEIV
KNASPSLRWLCLSASSIQDIDYSGSEALKQLHGELKKRGIVLVLSSVEDQVMHQLERDNL
IDLIGKEHIFEFTRDMIVAYQKLPERS
Download sequence
Identical sequences B8GI19
521011.Mpal_1434 WP_012618078.1.75456 gi|219852050|ref|YP_002466482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]