SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852059|ref|YP_002466491.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852059|ref|YP_002466491.1|
Domain Number 1 Region: 116-331
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.79e-27
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0092
Further Details:      
 
Domain Number 2 Region: 28-81
Classification Level Classification E-value
Superfamily PKD domain 0.000000000131
Family PKD domain 0.0048
Further Details:      
 
Domain Number 3 Region: 328-408
Classification Level Classification E-value
Superfamily PKD domain 0.0000000012
Family PKD domain 0.0036
Further Details:      
 
Domain Number 4 Region: 428-477
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000432
Family Type I dockerin domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852059|ref|YP_002466491.1|
Sequence length 479
Comment PKD domain-containing protein [Methanosphaerula palustris E1-9c]
Sequence
MNDHQTLVPARTVYLLIAALLLLVGTASAAAPIAAFTSTPAFGTVPLTVNFTDTSTGSPT
GWAWFFGDETYTQPWIEQNTSSGWSKRGYIRSVAMPDGSIVLMGGYGNSTYLNDTWRSTD
NGKTWTEQNPSSGWSGRAEQSCVAMPDGSIVLMGGYGNGTFLNDTWRSTDNGRTWTEQNS
SSGWSGRIEQSSVAMLDGSIILMGGYDGNSNQNDVWRSTDFGVTWTQLPDAAWSPRSCFT
VVVTRDSSIVLTTGVELDGTWKNDVWRSTDGGLTWTEMTPSASWEERRWHGCVAMPDGSI
VLMGGDGPVGWNDVWRSIDDGATWTQLPDAAWSPRARLGCVAMTDGSIVVMGGGGQNDTW
RFQPAGSTLQNPSHTYTTAGTYSVALQAFTAAGYSSTHQVSVAVVPMPSISPSVNTPQDL
NHDGLYEDLDGNGVFDFNDVVLFFNQMDWIADYEPVTAFDFDRNGRIDFNDIVVLFTTL
Download sequence
Identical sequences B8GI28
WP_012618087.1.75456 gi|219852059|ref|YP_002466491.1| 521011.Mpal_1444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]