SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852082|ref|YP_002466514.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852082|ref|YP_002466514.1|
Domain Number 1 Region: 518-657
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-25
Family Family 6 carbohydrate binding module, CBM6 0.0015
Further Details:      
 
Domain Number 2 Region: 681-733
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000746
Family Type I dockerin domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852082|ref|YP_002466514.1|
Sequence length 735
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MTSEDKFSREEPIMTRSRLPLVVLMILGAWFIIHTAGAVSLTIDYPSPNETTMAEMRDFY
VTGAIPAGITTPGDVRIEVFSGASAVGTPVRTLESHVDPLTGTTPLSAIAADYPNGSAKG
TVMVPDLVSEPGGLLETWNKVIVTPEYYSGLVLGGATKQFDTTYTDRDGRPLHDLVAGEF
TIRVTGLSGDLHGLTAEKQITLGKTHAALGRFSPPAQVNRLTAFARENGYRTYIDSFPGY
FFWNNTGYVIPGRWVRNNAIEVVNDCPGTTVDTVGAAENDLFLYNIRNTSATYTIETSTL
IRTGMVDSPQTVYHYYTAGEPVYTYTARENGSRVSFNSTLSTLAHGDRLALTRAELRMEN
DSDPIVDLADTTQKRLDLLPGDGIDVESDETCLLYGVVAPIPAPVVPGPSGKDGTPTNRI
ASIEWTLVDAGGAAVANSTIPVELGRRTDPAKPSEITTSLYEFGGAIGTGTPPGRYTLSI
KGLDETGTAVDGTTEEVPLCIDATPTPTPEPNTNHLVSGRIEVEDYDLGGEGVAYHDTTA
GNEGGVYRQDDVDIEMTGGEKTPNVGWVRDGEWLCYTTNVTQSGNYTVTARVASPHSGRQ
ITLSVAGGDTASIAVPDTGSFATFANVTVPIHLTAGTHSLVLTFFGDGQNIDWLTFTQET
VPIKIVPGGSGIPLDLNGDGWYEDVNGNGVFDFHDVVLFFNQMDWIEANEPVAGFDFNGN
GRIDFNDIVTVFNEV
Download sequence
Identical sequences B8GI51
WP_012618110.1.75456 521011.Mpal_1469 gi|219852082|ref|YP_002466514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]