SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852087|ref|YP_002466519.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852087|ref|YP_002466519.1|
Domain Number 1 Region: 184-452
Classification Level Classification E-value
Superfamily NHL repeat 5.75e-52
Family NHL repeat 0.0000338
Further Details:      
 
Domain Number 2 Region: 34-261
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-39
Family YWTD domain 0.0038
Further Details:      
 
Domain Number 3 Region: 418-621
Classification Level Classification E-value
Superfamily NHL repeat 3.14e-35
Family NHL repeat 0.00026
Further Details:      
 
Domain Number 4 Region: 617-666
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000116
Family Type I dockerin domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852087|ref|YP_002466519.1|
Sequence length 668
Comment NHL repeat containing protein [Methanosphaerula palustris E1-9c]
Sequence
MKFKYFFYFFCALLLLCCSAQAVSVEGGYAYVTQWGSSGQEAGQFNQPYGVTIDSIGDVY
VVDTYNNWIQKFDSNGTFLKKWGSFGTGDGQFNIPYDIAVDSVGYVYVADMNNNRIQKFN
STGGYLTQWGTKGSEEGQLDQPGSVAVDSRGQIYVADWGNNRVQVFNSTGGYLMQWGSSG
SGDGQFDGPNGIAIDSTGNVYVTDAYNNRIQEFNSTGGYLMQWGSSGSEAGQFEIPQGIA
MDSNDNVYVADSGNRVQKFTSAGTFITQWGTKGSEAGQFSNPFGIAVDSADNVYITDVYN
NRVQKFTSAGTFITQWGSQGLEVGQFNMPYGDAVDSAGNVYVTDLGNSRVQKFTANGTFI
TEWGSSGSGDGQFNMPYGIAVDSADNVYVADLNNNRVQKFNSTGSYLTQWGMTGSGNGQF
DQPCGVAVDRFGIVYVTDFGNNRVQMFTSAGGYLSQWGSHGPGAGQFSGPNGIALDSTGN
VYITDWGNNRVQKFTSTGSYLRQWGSSGSEDGMFGDSTSVAVDRDSNVYVSDSSNHRIQK
FDQNGTFITKWGSYGLEAGQFNSPFGITVDGAGNVYVTDVNSNRVLKFAPTGTTPVVIVP
GGSAVPQDLNHDGLYEDVDGNGVLDFGDVVLFFNQMDWIAENEPISAFDFNKNGQIDFND
IITLFNEL
Download sequence
Identical sequences B8GI56
gi|219852087|ref|YP_002466519.1| 521011.Mpal_1474 WP_012618115.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]